General Information

  • ID:  hor001874
  • Uniprot ID:  P29794
  • Protein name:  Glicentin
  • Gene name:  GCG
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031769 glucagon receptor binding
  • GO BP:  GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0014823 response to activity; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
  • Length:  69
  • Propeptide:  MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEEFRRRHADGSFSDEMNTVLDTLATRDFINWLLQTKITDRK
  • Signal peptide:  MKSIYFVAGLFVMLVQGSWQ
  • Modification:  T34 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P29794-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001874_AF2.pdbhor001874_ESM.pdb

Physical Information

Mass: 938294 Formula: C346H543N107O119S2
Absent amino acids: C Common amino acids: SD
pI: 7.54 Basic residues: 12
Polar residues: 22 Hydrophobic residues: 14
Hydrophobicity: -147.68 Boman Index: -26772
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 42.46
Instability Index: 9428.12 Extinction Coefficient cystines: 8480
Absorbance 280nm: 124.71

Literature

  • PubMed ID:  3238052
  • Title:  Immunoreactive Glucagons Purified From Dog Pancreas, Stomach and Ileum